PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla001822
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family G2-like
Protein Properties Length: 379aa    MW: 42550.8 Da    PI: 6.9626
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla001822genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.2e-32244299156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+peLH+rFv+a+++LGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Cla001822 244 KQRRCWSPELHRRFVDALHRLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 299
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.24E-18241302IPR009057Homeodomain-like
PROSITE profilePS5129414.192241301IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-29243303IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-26244299IPR006447Myb domain, plants
PfamPF002492.5E-8246297IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MELSLDLSLD FSPKTIPEIL HELSSISDSF TKRSKLDDYV RRLEDEMRKI DAFKRELPLC  60
VLLLQDAILR LKEEVLQFQS LKDQPVIEEF IPLKGDQPDE ETEKRKTRKW LSSSQLWNTN  120
FNFVDDEISN PKSNVNLNGD EDDRSVPQTP IENWDCPKRR RAFELFKDQN NFVKRATKED  180
VAFSEVPKLT LMTPISDPFP VNLTVKSGGC GGRNGRASVS GLSSPAAQMK GQAKLSQQQQ  240
TIRKQRRCWS PELHRRFVDA LHRLGGSQVA TPKQIRELMQ VDGLTNDEVK SHLQKYRLHV  300
RKLSPAEGSS GDGWIPGEHG GEHHSKTSVT HAGSPDGPLH GGGSGKALSI TEGESMEGEE  360
DAKSDGHSWK GRIQKHGDA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818751e-161LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132621e-161LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440244.10.0PREDICTED: uncharacterized protein LOC103484758
TrEMBLA0A0A0KIA90.0A0A0A0KIA9_CUCSA; Uncharacterized protein
STRINGVIT_07s0197g00060.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.14e-61G2-like family protein